SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694714|ref|YP_008797768.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694714|ref|YP_008797768.1|
Domain Number 1 Region: 388-465
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000356
Family MJ1460-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694714|ref|YP_008797768.1|
Sequence length 468
Comment hypothetical protein CSUB_C1287 [Candidatus Caldiarchaeum subterraneum]
Sequence
MNPCNGFYMLIRIVLPLPFRELSGERPRPFAGEQFKTGNKEFDEIVKFTGGAAVLVLDES
FAEGRNFIQTLFAKKPIMEIISPRGSSESRNVLHVEVDNLQSLSIQVNTVRKTHQPMILL
HLYLPDILVKHGEENVLRMINFWLDEIRRNGHLEFFIIPKHTFIDFERKLLSIVDGALEL
SVEKKQSGYETFFTPIRLSDDRHNLKPVSYVIEDGKLLVRPQMQTPESALARVRQLIMSG
EEVKVVLTGKQAGKISLSHYFLLREVSGWSLGWIAEAFWDELDDVLKSLGILYDSGVIKF
VTIPVERSFLAEKVGNYGQKLAVVFTAGFEELAETVTGYLNHDKDKDLKLGYTLSYLRQL
YARLYAYARASIESTSFDTLLAKMLREQLGLKADVKKKSSKIFVVEVKSCPVCGELDTIE
DPQHCQEAFSPMLSGAARAVLKTGVEVSELECSGKGGKKCVFVVKVLS
Download sequence
Identical sequences E6N7T9
gi|557694714|ref|YP_008797768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]