SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694835|ref|YP_008797889.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694835|ref|YP_008797889.1|
Domain Number 1 Region: 8-255
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.69e-83
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000478
Further Details:      
 
Domain Number 2 Region: 240-394
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.42e-50
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694835|ref|YP_008797889.1|
Sequence length 401
Comment acyl-CoA dehydrogenase [Candidatus Caldiarchaeum subterraneum]
Sequence
MVFPFSSVFDFAVEVKEEYEIFRKSVRAFAEKEIEPLVKEIERTNTIPKALLKKAAEQGY
LGLGIPETYDGQGTDMMYSTLFVEEVSRICPAFTVATLVGVLFTYPVMVYGTEEQKRKYL
PPIARGEKFAAHATTEPGAGTDVAGIETTAKRKNGGWEINGRKYFISGADKADYFIVLAR
TSPPPSRKERHKGLSFFIVERGTPGFRVGEKIEVIGIRGSHPCEVILDNVYVPEENMVGE
EGQGFKIAMDTYDHGRIGVAAQAVGVAQACLEKTLQYSLQRRVFERPLIYFQAVQFHVSE
MLTMLEGARLMLYWATTLANKNRPEAVMAASMAKLYATEVAEKAALKAITVHGGVGVATD
GLVERFLRDSQVFKIYEGANDIQKLVILRQMMKTAFGMDVD
Download sequence
Identical sequences A0A2H5V7C9 E6N886
gi|557694835|ref|YP_008797889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]