SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694867|ref|YP_008797921.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694867|ref|YP_008797921.1|
Domain Number 1 Region: 247-604
Classification Level Classification E-value
Superfamily SIS domain 5.01e-96
Family double-SIS domain 0.000000726
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.15e-71
Family Class II glutamine amidotransferases 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694867|ref|YP_008797921.1|
Sequence length 605
Comment glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [Candidatus Caldiarchaeum subterraneum]
Sequence
MCGIVGYVGAGAAAPILVRGLKRLEYRGYDSAGVATISGNVLLVEKDAGKVDELNAKLSL
DKMPGNIGIAHTRWATHGAPSKVNAHPHTDCTGTVAVVHNGVLENFLQLRKELTDLNHNI
VSRTDTEVVPHLVEDFMKRGMGFEEAFVNAVRRLEGSYALAAICLREPDLIMVARKEAPL
IIGVGDGFNMVASDMTALIEMTNQMVFLHDGDAAAVRANGYRVFRVADGQIVERPVKTVA
LTVEMAEKQGHPHFMLKEIFEQPNSLRDALRTQREYVDLLAELLDKGRVVFLLGAGTSYN
ACLAGSYLFSAVARMPSYPVIASEFVANYGGAVGADTVILAVSQSGETADVLNALDFARM
RACTILGLTNTVGSTLTRVSRAYVLQNSGPEIGVAATKTFTSQVLVLAQIALRLSRLRGK
ISQFEMDDFGHELSKVPRLVEDVLLTAPAKVKELAETLVNSPFLFILGRGVSVSTAYEGR
LKVMELSYIPCIAYPSGESKHGPISVIEEKIPVIFVAPPDEFRKQNIGSIMEMKARGAKI
IIFGDREDEELRSLADHYIGLPKTHPLLSPIIYTVPFQLLAYYLAVLKGYDPDKPRNLAK
SVTVL
Download sequence
Identical sequences E6N8F2
gi|557694867|ref|YP_008797921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]