SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694929|ref|YP_008797983.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694929|ref|YP_008797983.1|
Domain Number 1 Region: 92-195
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 8.83e-30
Family CTP-dependent riboflavin kinase-like 0.00034
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000423
Family MarR-like transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694929|ref|YP_008797983.1|
Sequence length 199
Comment riboflavin kinase, archaea type [Candidatus Caldiarchaeum subterraneum]
Sequence
MANLSLRERVLIYLAEAGAITSSLKITTPILSRQFSTSQQSASRLLILLEKEGLIERRVV
GRTSYVKLTQKGVARLLDLYLTLKMIFERPVKVVLEGRVFTGYGEGVYYMSLPNYVKQMQ
EKLGFIPYPGTLNITLLSKDSIENKMLLQKYADIEIHGFRDEKRTYGDVKAVRVTVNDTE
PAYMIFPERTLYDNSVADS
Download sequence
Identical sequences E6N8M9
gi|557694929|ref|YP_008797983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]