SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557695141|ref|YP_008798195.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557695141|ref|YP_008798195.1|
Domain Number 1 Region: 10-156
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-33
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 177-276
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 8.11e-17
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557695141|ref|YP_008798195.1|
Sequence length 277
Comment carbon monoxide dehydrogenase medium subunit [Candidatus Caldiarchaeum subterraneum]
Sequence
MSTLGYLGIPRIEVMIPSSVEEALNLLQTHPDAEILAAGTHIITQLTLGIKRTRKYIDIN
NLHQLRKISHHHGTASVGSLVTHQELAATLMNQVPAFTAFLQKYSSPAVANRATVGGSIM
LRLAGEDLIPILLTLDAELSFATLEGVKNIPLKAFLARGFDGRGLLQTISFKLNSSCFFD
KLWMGVSRIPLISIAVSRDGADGVRVAVSHKDGSTPGRVAAVEKFLSMHGLSEEVVEKAS
RLMMDSINPESDVLASSWYRRRAAGVLLKRLLQNLRG
Download sequence
Identical sequences Q4LEB9
gi|557695141|ref|YP_008798195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]