SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472333118|ref|YP_007665393.1| from Mannheimia haemolytica USDA-ARS-USMARC-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472333118|ref|YP_007665393.1|
Domain Number 1 Region: 208-273
Classification Level Classification E-value
Superfamily TPR-like 0.0000289
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472333118|ref|YP_007665393.1|
Sequence length 288
Comment hypothetical protein D650_6150 [Mannheimia haemolytica USDA-ARS-USMARC-183]
Sequence
MDDIIEELLKELEDPKVTISETELKKFLYREILRLTTLIDKNVSEQQVFGQMSALVKKAR
YNVNGEGDEERINQLLHLVYREWGFHCYYEDYFHTENLLLNQVIRKRRGMPVSLGAVALY
LSAVLDLPLYPVNFPTQLVLRAEIHQPNGATKVRFINPWNGEFLTIEMLNKWLEGEMGFG
VEVTPDLLRRAEPQELLERVETVFKMALTREGKYEETLRLIEYRLAFSPEDPYEIRDRGM
VLASMDCYQAALEDINYFIDQCPEDPSAEILKMEVKGLQQKSQESVVH
Download sequence
Identical sequences A0A248ZXF5 M9X3R0
gi|525663458|ref|YP_008222425.1| gi|472333118|ref|YP_007665393.1| gi|526469415|ref|YP_008339647.1| gi|472337243|ref|YP_007669517.1| WP_006249579.1.100578 WP_006249579.1.101281 WP_006249579.1.14651 WP_006249579.1.15850 WP_006249579.1.18032 WP_006249579.1.19836 WP_006249579.1.21690 WP_006249579.1.22107 WP_006249579.1.24300 WP_006249579.1.25136 WP_006249579.1.2785 WP_006249579.1.28573 WP_006249579.1.29735 WP_006249579.1.33793 WP_006249579.1.34159 WP_006249579.1.34894 WP_006249579.1.42410 WP_006249579.1.42606 WP_006249579.1.43708 WP_006249579.1.45083 WP_006249579.1.47009 WP_006249579.1.50719 WP_006249579.1.52776 WP_006249579.1.55804 WP_006249579.1.61638 WP_006249579.1.62250 WP_006249579.1.63192 WP_006249579.1.63974 WP_006249579.1.73398 WP_006249579.1.73782 WP_006249579.1.73864 WP_006249579.1.74727 WP_006249579.1.74925 WP_006249579.1.76946 WP_006249579.1.78880 WP_006249579.1.8019 WP_006249579.1.802 WP_006249579.1.81289 WP_006249579.1.82341 WP_006249579.1.84529 WP_006249579.1.90102 WP_006249579.1.91740 WP_006249579.1.93146 WP_006249579.1.94296 WP_006249579.1.95684 WP_006249579.1.95739 gi|525702141|ref|YP_008233862.1| gi|482887464|ref|YP_007884637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]