SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472335118|ref|YP_007667393.1| from Mannheimia haemolytica USDA-ARS-USMARC-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472335118|ref|YP_007667393.1|
Domain Number 1 Region: 163-272
Classification Level Classification E-value
Superfamily TPR-like 8.54e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|472335118|ref|YP_007667393.1|
Sequence length 303
Comment Cytochrome c biogenesis protein [Mannheimia haemolytica USDA-ARS-USMARC-183]
Sequence
MNFWLAIIFVTLIVCGVAFYPLLKKNKQIDNTKRDSLNKAFYFDRLKEVENEANEGVIDD
PEQTKLELQKNLLDDIPHSTQSATSEKLTLGKSWFVALILFVGGISFAIYSNVGSWFSNS
MLDTTHQKLDSFYERLKTEETNPLSQEEMNQFAMALRVDLQSNPNDDKKWYMLGQIGMAL
DDGQLAHDAFSKAAQLKPDNLDYKLSHAQLLLFSEAQEDKKQGETLLKEIIRQDHTNFNA
LSLLAFHSFEKEDFKMAAMTWGMMLKLLPDEDPSKVTVERSFNMALSNLSEAEKQELQKG
EKK
Download sequence
Identical sequences A0A249A2N8 M9WVL1
gi|472335118|ref|YP_007667393.1| gi|526467575|ref|YP_008337662.1| WP_006249993.1.100578 WP_006249993.1.101281 WP_006249993.1.14651 WP_006249993.1.15850 WP_006249993.1.18032 WP_006249993.1.19836 WP_006249993.1.21690 WP_006249993.1.22107 WP_006249993.1.24300 WP_006249993.1.25136 WP_006249993.1.2785 WP_006249993.1.28573 WP_006249993.1.29735 WP_006249993.1.33793 WP_006249993.1.34159 WP_006249993.1.34894 WP_006249993.1.42410 WP_006249993.1.42606 WP_006249993.1.43708 WP_006249993.1.45083 WP_006249993.1.47009 WP_006249993.1.50719 WP_006249993.1.52776 WP_006249993.1.55804 WP_006249993.1.61638 WP_006249993.1.62250 WP_006249993.1.63974 WP_006249993.1.73398 WP_006249993.1.73782 WP_006249993.1.73864 WP_006249993.1.74727 WP_006249993.1.74925 WP_006249993.1.76946 WP_006249993.1.78880 WP_006249993.1.8019 WP_006249993.1.802 WP_006249993.1.81289 WP_006249993.1.82341 WP_006249993.1.84529 WP_006249993.1.90102 WP_006249993.1.91740 WP_006249993.1.93146 WP_006249993.1.94296 WP_006249993.1.95684 WP_006249993.1.95739 gi|525664112|ref|YP_008223100.1| gi|482885385|ref|YP_007882558.1| gi|525702531|ref|YP_008234273.1| gi|472335437|ref|YP_007667711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]