SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238898659|ref|YP_002924340.1| from Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238898659|ref|YP_002924340.1|
Domain Number 1 Region: 55-125
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000353
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238898659|ref|YP_002924340.1|
Sequence length 153
Comment hypothetical protein HDEF_1577 [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
Sequence
MGQVAFDTLQATEDLETVGMSREHARAISLIVRRSHEVADVATKADIADVKRDIADVRKD
LSAEIADVRKDLSAEIADVRKDMKIQSEKVDAQFADVRKDIDTRFEKVDAQFADIRKDMN
NKLEKLGLSLTIKMGGMIGFLVVSIGLMLKYLR
Download sequence
Identical sequences A0A2D3TES9 C4K6J9
572265.HDEF_1577 gi|238898659|ref|YP_002924340.1| WP_015873959.1.27657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]