SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226304788|ref|YP_002764746.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226304788|ref|YP_002764746.1|
Domain Number 1 Region: 20-233
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00000000144
Family Heme-dependent catalases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226304788|ref|YP_002764746.1|
Sequence length 240
Comment hypothetical protein RER_12990 [Rhodococcus erythropolis PR4]
Sequence
MTLNSIIPAGKSAIGKLVGAPFYFASSLRMARVFHPHGIELKGTLKPATPWWPVTESSTI
TVTARMSKALGIPGDLPDILGLALRLHDVGADENPWDILLATSGLSTFSKMFPAPAFSWN
GARYSTLVPYSRAGGAAAWLIVTPRGVHPAGTSLSALKAAVDHSPLHFSVYLARIQLQLI
PIGHLCLDEVEDHPDCLQPSFDPILNRPAHMRMLPEWLAETRKLAYRGSRDGRGDTQKRG
Download sequence
Identical sequences C0ZT34
gi|226304788|ref|YP_002764746.1| WP_020906558.1.2937 WP_020906558.1.69155 234621.RER_12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]