SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226306699|ref|YP_002766659.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226306699|ref|YP_002766659.1|
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily PEBP-like 4.58e-46
Family Prokaryotic PEBP-like proteins 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226306699|ref|YP_002766659.1|
Sequence length 178
Comment conserved hypothetical protein [Rhodococcus erythropolis PR4]
Sequence
MAHDPYEPLPKLPSFELTSDDITAGQPLKLAQASGAFGVPGGEDISPQLSWSGFPAETKS
FVVTVFDPDAPTASGFWHWAVANIPASVTELPAGAGAVDSDVLPAGTVTLRHDGGGFGFI
GAGPPPGHGPHRYIVAVHALDVETLDGVTPDSSPAFLGFNVFHHAIARATLTGTFEVE
Download sequence
Identical sequences C0ZZY5
WP_020907829.1.2937 234621.RER_32120 gi|226306699|ref|YP_002766659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]