SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226307410|ref|YP_002767370.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226307410|ref|YP_002767370.1|
Domain Number 1 Region: 64-333
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.94e-71
Family Alanine racemase-like, N-terminal domain 0.00000000289
Further Details:      
 
Domain Number 2 Region: 311-471
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.15e-44
Family Eukaryotic ODC-like 0.00000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226307410|ref|YP_002767370.1|
Sequence length 473
Comment diaminopimelate decarboxylase [Rhodococcus erythropolis PR4]
Sequence
MNAHPAGPKHAEQLQAPGLPDRPASPEAFGELSPQVWPRNASRGDDGEVTLAGVKVGELA
EKYGTPLFVIDEDDFRSRCRDMARAFGPDAKVHYASKAFLCGEIARWVADEGLSLDVCSG
GELAIALHADFPAERIAMHGNNKSVAELAAGVAAGVGHVVLDSAIEIDRLDRVAGEAGVV
QDVLIRLTVGVEAHTHEFISTAHEDQKFGFSLAGGAAIDAVRRVFAADNLRLVGLHSHIG
SQIFDVDGFEVAAHRVIGLLRDVVTEFGVEKTKQISIIDLGGGMGISYIPSDDPPPVDEL
AAKLGHIVRNESALAGLPEPTLAVEPGRAIAGPGTVTLYEVGTIKDVTVGSSLTRRYISV
DGGMSDNIRTSLYGAEYEAKLVSRTSEADPVVARIVGKHCESGDVVIRDTWMPEDVGPGD
LLAVAATGAYCYSMSSRYNLLTRPAVVAVRDGVSRVILRRETVEDLLSLEVSQ
Download sequence
Identical sequences A0A0E4A8X5 C1A1Z6 U0FG01
gi|532365795|ref|YP_008454194.1| 234621.RER_39230 gi|226307410|ref|YP_002767370.1| WP_019749182.1.17328 WP_019749182.1.2937 WP_019749182.1.3298 WP_019749182.1.37275 WP_019749182.1.38104 WP_019749182.1.40047 WP_019749182.1.58082 WP_019749182.1.61491 WP_019749182.1.69155 WP_019749182.1.77150 WP_019749182.1.78616 WP_019749182.1.79292 WP_019749182.1.81178 WP_019749182.1.83724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]