SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226309238|ref|YP_002769198.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226309238|ref|YP_002769198.1|
Domain Number 1 Region: 55-573
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.01e-204
Family Heme-dependent catalases 0.0000000000586
Further Details:      
 
Domain Number 2 Region: 580-723
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000011
Family Catalase, C-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226309238|ref|YP_002769198.1|
Sequence length 732
Comment catalase HPII [Rhodococcus erythropolis PR4]
Sequence
MTIKRSCSMPSSQSVPGAPAPKAPDLKEPVKPRQPLPPKDDQRQPEVRTVAGAEEKVKGN
GRGQRGEYLTTATGTRLYETDHSLTAGERGPTLLQDHHLREKITHFDHERIPERVVHARG
AAAHGTFLANGAAENICKASLFASGARTPVFVRFSTVLGSRGSADTVRDTRGFATKFYTD
EGVFDLVGNNIPVFFIQDGIKFPDIIHAAKPHPDREIPQAQSAHDTFWDFVSLHTEATAH
TLWNMSDRGIPRSYRMMEGFGIHTFRLVNADGETNLVKFHWKPAAGVHSLVWEEAQIAGG
VDPDFHRRDLADAIEAGAYPSWDLGVQVFPDTEDEMFEGIDLLDPTKIVPEELAPVQVIG
TMTLDANPTNFFAETEQVAFHPGHLVPGVDITNDRLLQARLFSYLDTQITRLGGPNFDQI
PINRPHAPVNDMLRDGFHQDGVHTGVAPYHPNSLDGGCPFMASADSAAYIEVPQEVSGRK
VRQAPASFDDHFSQARLFYRSLSPVEQEHVAQAYTFELGKCYEENIKTRNLGILANIDAG
LVSIVAGGLGLPVPEPTEPLSDPELSPALSQVGAEWPVDGRIIALLVDENSDLDTVVAIR
DKIFDAGMVPLILGPHGGTIGDGDDAVTVQRTYLTARSIEFDAILLSGDVSRIGEGKLDP
RVETLLNEMYRHSKAIGGWGESMGALAAAGIDESALGVVVDADAEGALASLAQLLKTHRV
WGRFEVPPTPSE
Download sequence
Identical sequences C0ZU43
234621.RER_57510 gi|226309238|ref|YP_002769198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]