SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256826682|ref|YP_003150641.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826682|ref|YP_003150641.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000952
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 72-136
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.0000000000000314
Family C-terminal domain of arginine repressor 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256826682|ref|YP_003150641.1|
Sequence length 144
Comment arginine repressor [Cryptobacterium curtum DSM 15641]
Sequence
MKKRMQRHDIIREIVRDNEIRTQRELASKLQAKGHECTQATISRDITDMGLLKSSEGIYV
LPEDMRLHHMVAELVEEVYTAGYLVVVRTFPGGAAGVAGSIDNAGLVGSLGTVAGDNTIM
IAARTPEDAESIREILDGLRRHRS
Download sequence
Identical sequences C7MM19
469378.Ccur_02280 WP_012802648.1.80809 gi|256826682|ref|YP_003150641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]