SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256826780|ref|YP_003150739.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826780|ref|YP_003150739.1|
Domain Number 1 Region: 6-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-80
Family Protein kinases, catalytic subunit 0.00000175
Further Details:      
 
Domain Number 2 Region: 570-631
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|256826780|ref|YP_003150739.1|
Domain Number - Region: 500-559
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 431-494
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000118
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 364-407
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256826780|ref|YP_003150739.1|
Sequence length 651
Comment serine/threonine protein kinase [Cryptobacterium curtum DSM 15641]
Sequence
MIGRVFNNRYQLTERIGIGGMAEVYRAQDRVLGRLVAVKVMLPQYASDPEFTQRFRQEAA
AAANLQSPYIVNVYDWGQDEGIHYMVMEYVRGSDLKTAITQRGAINQRKVAEIGAQVCKA
LSVAHNQDIIHRDIKPQNIMVQPDGNVKVMDFGIARAKNSMKQQTSAVLGTAHYISPEQA
QGKELTPASDIYSLGVVLYEAATGKLPFDGPDSVSVAMKQVSDAPVPPREVNPDLDPNLE
AIILRALEKDPAARFATVNDMKHALNDYLAGRPVSLDDDATHVMSNGTFVPPISNAAGAT
SVMQPLASEGSPVSGAPSVMRAVDEEEQAKHKKRRNAVIVAIIAAVALLVAAIAFALSGM
NGSSMVPDVTGQTAQQAEATLKSAGYTIGTTTEVYDDSTDEGRVVSTDPPAGTTVEKGSA
INLNISKGKGQVEVPDLNGMNADQAKQALTKAGLTASQGTAVASDEVAKDKVATQDPAAG
TKVEKGSTVTFSLSSGPESVSVPDITGMSEKEAQAALSNVGLTGSLSDRKASDKVAEGDI
ISQSPSAGKKVSKGSKVSYVISTGPSVVTVAVPNLTGMTKDGAKSALTEKGLVLGDVTEK
SSDKPKGTVIEQSTDSGTKVEKGSKVNIVISSGQGVLNSLVNPSSSTTTTS
Download sequence
Identical sequences C7MMB7
gi|256826780|ref|YP_003150739.1| WP_012802745.1.80809 469378.Ccur_03300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]