SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256826966|ref|YP_003150925.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826966|ref|YP_003150925.1|
Domain Number 1 Region: 2-300
Classification Level Classification E-value
Superfamily Aldolase 2.38e-85
Family HMGL-like 0.000000347
Further Details:      
 
Domain Number 2 Region: 296-444
Classification Level Classification E-value
Superfamily post-HMGL domain-like 5.1e-41
Family Conserved carboxylase domain 0.0000236
Further Details:      
 
Domain Number 3 Region: 546-621
Classification Level Classification E-value
Superfamily Single hybrid motif 4.58e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256826966|ref|YP_003150925.1|
Sequence length 634
Comment acetyl-CoA carboxylase [Cryptobacterium curtum DSM 15641]
Sequence
MPKLQLMDTTIRDGQQSLWATRMPVGDMLPILPAMDKVGYWAIEAWGGATFDTCLRFLDE
NPWERLRQIKAKTPNTRLAMLTRGQNLVGYKHYSRDIVNRFLKAAQRNGVDVFRVFDALN
DIRNVTDSAEAVKEAGGWFEGAISYTISPVHTLDSYLEYAQQLKELGADSIAIKDMAGML
TPYRTERMVRALNDEIGLPVHVHCHYVGGMAPANILKAAEAGAAIADTASAPLAFGNSQP
AVEMIVAALQESAFSTGYDLDLLFEIAEYWEEVRRRTHHKRGVSSLTHMKVYSHQVPGGM
MSNLMAQLEVQNAADRIDDVMREIPKVRAEVGYPPLVTPMSQIVGTQAVFNVITGKRWGV
VSKEMKDYICGYYGKAPGPMDAEIVKKVVGDSAILPPDVAPSSLVTTTYESVADEIGDLA
KTEEDVLMYALFPNEARTYLSKHRTSEKVDFLMEGESSGTKEDDYVDINQIRELVRVAEE
SGVGEIVVEEEGARIAVRMPGMMSVAPAAVPAANGAAPVAASASVPAAAPAAPVADAANT
RPASWKPVCAPMVGTFYAAPAPGEPAFVSVGDEVTAGQTLAIIEAMKLMNEIGADEMGTI
REVCIEDAQPVEFGTVLFYLEPHNTAEATGPESA
Download sequence
Identical sequences C7MMV3
WP_012802931.1.80809 gi|256826966|ref|YP_003150925.1| 469378.Ccur_05220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]