SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827009|ref|YP_003150968.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827009|ref|YP_003150968.1|
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily RNase III domain-like 1.73e-39
Family RNase III catalytic domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 157-231
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.56e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256827009|ref|YP_003150968.1|
Sequence length 279
Comment ribonuclease III [Cryptobacterium curtum DSM 15641]
Sequence
MVTHDEQREKLDRAQEVLGYRFSDEHFLLSAITHPSAVEGMPVKFSYERLEFLGDSILGA
VVADAAFHRFPDLDEGGLTRIKVSLVAGSSLSQVANELGFADFIIFGQSEAGTGRRGLHS
ALENVYEAVVAALYLDGGMEVARSFIVQTLLGYMSIDMAREPENPKSALQEKLQEDGITP
TYKLIETQGPPHDRTFVAAVYAGLQALARGVGRTKKEAESKAAQTALSHLPDEKHKRHKD
KGKDKAEHRKKGATSHSQDNDTGEKPIPDTVASNTAGRE
Download sequence
Identical sequences C7MMZ6
gi|256827009|ref|YP_003150968.1| WP_012802974.1.80809 469378.Ccur_05680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]