SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827328|ref|YP_003151287.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256827328|ref|YP_003151287.1|
Domain Number - Region: 15-84
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0314
Family The homologous-pairing domain of Rad52 recombinase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256827328|ref|YP_003151287.1|
Sequence length 94
Comment hypothetical protein Ccur_09070 [Cryptobacterium curtum DSM 15641]
Sequence
MKTYRAHYKSPVGEHPTSGIFEFESSAQAGSKKNMTDARIKMLEVFGNEAVTWIIDQIEL
VRQDETLDYVQPQLDFREPKRVRRHHTFERGKIK
Download sequence
Identical sequences C7MNW5
WP_012803291.1.80809 gi|256827328|ref|YP_003151287.1| 469378.Ccur_09070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]