SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827388|ref|YP_003151347.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827388|ref|YP_003151347.1|
Domain Number 1 Region: 9-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-64
Family G proteins 0.000000133
Further Details:      
 
Domain Number 2 Region: 308-400
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.32e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 211-307
Classification Level Classification E-value
Superfamily Translation proteins 6.09e-30
Family Elongation factors 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256827388|ref|YP_003151347.1|
Sequence length 400
Comment translation elongation factor 1A (EF-1A/EF-Tu) [Cryptobacterium curtum DSM 15641]
Sequence
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAISKTLSSNDGSHGTAHADFTAFEDIDKAP
EERERGITISIAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVIAATDGPMA
QTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSSYDFPGDETPIIRGS
ALKALEGEKEWQDKIWELMDAVDEWIPTPTRDTEKPFLMAIEDVMTIPGRGTVVTGRVER
GVLHVGDELEILGIRETQKTTCTGVEMFRKLLDEAEAGDNIGALLRGIKREEVVRGQVLC
KPGSVTPHTEFKGQIYVLTKEEGGRHTPFFDGYRPQFYFRTTDITGVVHLPEGTEMVMPG
DNVEIKGELIHPVAMEEGLKFAIREGGRTVGSGRVTEIIK
Download sequence
Identical sequences C7MP25
469378.Ccur_09710 WP_012803351.1.80809 gi|256827388|ref|YP_003151347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]