SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827396|ref|YP_003151355.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827396|ref|YP_003151355.1|
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 8.24e-18
Family Ribosomal protein L30p/L7e 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256827396|ref|YP_003151355.1|
Sequence length 63
Comment 50S ribosomal protein L30P [Cryptobacterium curtum DSM 15641]
Sequence
MASKQKMLHVKQVRSTIGRPATQERTLKGMGLGRIGKERDLPDNESTRGMIFKVKHLVEV
TEA
Download sequence
Identical sequences C7MP33
WP_012803359.1.80809 469378.Ccur_09820 gi|256827396|ref|YP_003151355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]