SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827441|ref|YP_003151400.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827441|ref|YP_003151400.1|
Domain Number 1 Region: 10-203
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 8.86e-54
Family Class I glutamine amidotransferases (GAT) 0.0000138
Further Details:      
 
Domain Number 2 Region: 186-429
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.6e-45
Family N-type ATP pyrophosphatases 0.0000196
Further Details:      
 
Domain Number 3 Region: 399-530
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.44e-44
Family GMP synthetase C-terminal dimerisation domain 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256827441|ref|YP_003151400.1|
Sequence length 530
Comment GMP synthase (glutamine-hydrolyzing) [Cryptobacterium curtum DSM 15641]
Sequence
MSTAAVPDQKVIVLDFGAQYGQLIARRVRDLHVYSEIVPCDISAAELAEMKPSAIILSGG
PASVYAEDAPAIDPAVLELGVPVLGFCYGQQIMATTLGGTVGHTEKGEYGAATLTRNGMS
LLLGDTPQRQTVWMSHRDAVTDVPEGFVVTAQTDVCPVAAMECIERDLYSTQFHPEVRHT
PYGQDMLSNFLFDICELEPNWTMDGIAQGMIDAIRAQVGSDRMILALSGGVDSSVVAALC
AKAVGKQLTCVFVNHGLLRKGEPEQVEEVFTKQFDIDFVHVHAEERYAKLLAGVVDPEQK
RRIIGTQFWKEFFAVAQETGGIKYLAQGTIYPDIIESGARKTGGKASTIKSHHNLIPFPE
GVRFDLIEPLDHFFKDEVRALGEALGLPDHIVHRQPFPGPGLAIRIIGAVDAEKLVLLKD
ADAIVREELDAYNEWLIEQTGERNSEHAAWQYFAVLPDIKSVGVMGDERTYARPIILRAV
ESSDAMTADWAKLPYEVLTRISSRIVAEVPGINRVAYDITSKPPATIEWE
Download sequence
Identical sequences C7MP78
WP_012803403.1.80809 gi|256827441|ref|YP_003151400.1| 469378.Ccur_10270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]