SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827546|ref|YP_003151505.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827546|ref|YP_003151505.1|
Domain Number 1 Region: 104-202
Classification Level Classification E-value
Superfamily DsrEFH-like 0.000000000000412
Family DsrEF-like 0.038
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000235
Family SirA-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256827546|ref|YP_003151505.1|
Sequence length 203
Comment redox protein, regulator of disulfide bond formation [Cryptobacterium curtum DSM 15641]
Sequence
MMDLIIDARGDACPLPVVKAKQALSQVDEGTVTVLVDNETAVENLGNLAKSLKAASEHER
TPEGDFAVRIMKDGSSNLSDVSTESAGGTAKVGPRVVVLSASTMGTGDDTLGAALMKAFV
FALTQQDVLPDTVLCYNGGVHLTCEGSESLDDLRALAAAGVEVLSCGTCLNHFGITDKLA
VGEVTNMYVIAEKQLTAGVIVRP
Download sequence
Identical sequences C7MPI3
469378.Ccur_11340 gi|256827546|ref|YP_003151505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]