SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827552|ref|YP_003151511.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827552|ref|YP_003151511.1|
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.81e-46
Family G proteins 0.0000633
Further Details:      
 
Domain Number 2 Region: 175-259
Classification Level Classification E-value
Superfamily Translation proteins 2.36e-21
Family Elongation factors 0.00087
Further Details:      
 
Domain Number 3 Region: 262-359
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.24e-18
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0065
Further Details:      
 
Domain Number 4 Region: 601-654
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000187
Family C-terminal fragment of elongation factor SelB 0.0098
Further Details:      
 
Domain Number 5 Region: 462-526
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000408
Family C-terminal fragment of elongation factor SelB 0.029
Further Details:      
 
Domain Number 6 Region: 534-594
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000536
Family ReutB4095-like 0.062
Further Details:      
 
Weak hits

Sequence:  gi|256827552|ref|YP_003151511.1|
Domain Number - Region: 379-433
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00301
Family MarR-like transcriptional regulators 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256827552|ref|YP_003151511.1|
Sequence length 657
Comment selenocysteine-specific elongation factor SelB [Cryptobacterium curtum DSM 15641]
Sequence
MLGTAGHIDHGKSSLIKALTGTDPDRLSEEKRRGITITLGFARIDLPDGRSMGVVDVPGH
ERFVKQMIAGASGIDVALLVIAADDGIMPQTIEHVAVLQTLGVRTCIVALTKIDMVDAEW
VTFMKGEVESWLASTSYAGCPIVPVSSKTGEGLDELRAALQKAAEKTQRVHQGSTTRLPV
DRVFTIKGAGTVITGTLWDGTVSPEDTLEILPSGKLARVRSVQVHGQTCDEASAGMRLAL
NLSNIKKDEINLGDFLAAPGCLHMTDRFDARITYLDVAKTGKPLKTGTRMHLAHGTREVL
ARVLLCNDIEQIASGQSALAQIRLEEDLPISWGDRFILRTYSPVSVAGGGQVLLAHPHRR
STLDAEEMKLIEASETGDIRQMVERVCSLAAGPLHTSEVARLIGISPAQAAEYLADLTQA
GALTSSHSGSAASQSSAPTKSPTSSVPLPADDALFIAKNKKQQAIAAIERELIAFCADHP
HERGITKEALHAQIAPHISDEGFEALLNWAVKAKSAVITGNVVGHPSSQQGAAAAEERAA
EQIHQALIAEGMTPRPIERILESCDLDASLAHRALAHLESNGKAIRIARDLYFDAATLDE
RIALVQQWISQHGAGTVAELKEPLGTSRKYAVPLLEHLDAQGITVREGDKRSLRPRR
Download sequence
Identical sequences C7MPI9
gi|256827552|ref|YP_003151511.1| 469378.Ccur_11400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]