SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256827646|ref|YP_003151605.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827646|ref|YP_003151605.1|
Domain Number 1 Region: 15-123
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.58e-23
Family Siroheme synthase N-terminal domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 119-217
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.31e-16
Family Siroheme synthase middle domains-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256827646|ref|YP_003151605.1|
Sequence length 255
Comment siroheme synthase, N-terminal domain protein, partial [Cryptobacterium curtum DSM 15641]
Sequence
MQDATEAPVGRHAGYPLFVDLEDRLVVVIGGGAIAEHKLRTLLRYGARIKIVSPKITEGI
QALVDEGKVEWIPRVYELGDLAGASIAFSVCGIPAVDVRIHEEARSRNCLLNVADVPEEC
DFIVPSIVRRGLLSIAVSTSGAACTEAKRIRHRLEDDFDESWVAYLDLMTQVRDLVKERI
SGGHDARKPIFEAAADAGWRKRLAAGERISVEDAYNEAVALAQSVSQTTSESGGHASAVK
HDEPTTTATTAGKER
Download sequence
Identical sequences C7MKX6
gi|256827646|ref|YP_003151605.1| 469378.Ccur_12390 WP_015778786.1.80809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]