SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258650298|ref|YP_003199454.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650298|ref|YP_003199454.1|
Domain Number 1 Region: 265-374
Classification Level Classification E-value
Superfamily OmpA-like 0.00000000196
Family OmpA-like 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|258650298|ref|YP_003199454.1|
Domain Number - Region: 66-122
Classification Level Classification E-value
Superfamily PKD domain 0.0883
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258650298|ref|YP_003199454.1|
Sequence length 378
Comment OmpA/MotB domain-containing protein [Nakamurella multipartita DSM 44233]
Sequence
MSRRRTPPTLPVRLPILAAAVALLTLTACSSGGSSGSGESSAAPTSAAPVTVAGSVVSTA
GSSNEAQIVVPEVVAAQWAALGSGNGVEWVAVAGDGTTSTTPVAVADADATSAFTAQLNA
LQAASPGRDALAGLDAVASPAGSPVWVFSPLLDTQGALDMNLLAFDQSPPDVVSAATASG
ALPDLTGREVNFVVTPVAGQQNALSDVQVGYQHAIWEGIATAAGASTVTFYDGTGTGAGT
GTIPAVATPDPTDKISSEGSGPTRTCTLPTPALFLPNQAALIDKAATLTALSECVGTVDP
STKISVEGRTAAVPGGDPQGAIDLSTQRATEVAVLLQEVGVPGENITSVVGLGDSSPLVQ
PASDPENRSVVVTFTSTG
Download sequence
Identical sequences C8XHX4
479431.Namu_0027 WP_012813940.1.85990 gi|258650298|ref|YP_003199454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]