SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258650346|ref|YP_003199502.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650346|ref|YP_003199502.1|
Domain Number 1 Region: 6-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-78
Family Protein kinases, catalytic subunit 0.00000000793
Further Details:      
 
Weak hits

Sequence:  gi|258650346|ref|YP_003199502.1|
Domain Number - Region: 436-497
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0119
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 
Domain Number - Region: 368-430
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258650346|ref|YP_003199502.1|
Sequence length 676
Comment serine/threonine protein kinase with PASTA sensor(s) [Nakamurella multipartita DSM 44233]
Sequence
MTGYLFGDRYQVGDTLGFGGMSEVHRGRDLRLGRDVAIKVLRADLARDPSFQARFSREAQ
NAASLNHPAIVAVYDTGETKNDSGTIPYIVMEFVDGDTLRDVLKKEGPLAPRRAMEIVAD
VCAALDFSHRHGIVHRDIKPANIMLNRAGAVKVMDFGIARAVSDGQATMTATAAVIGTAQ
YLSPEQARGEAVDARSDVYATGCVLFELLTGEPPFTGDSPVAIAYQHVREAPRAPSDVRP
GLPKEMDAIVLKALNKNPLNRYQTAADMRSDLVRALSGQAVQATPLMSDDERTELMRATP
ARVGAGSPPLLAPPTRAATDDDWEPEEADRSKRVWGFIGIGLLCAALIAGAIWLTLRVIS
APPPAALVAVPDLSGMSLEEATAKLRDSRLTLGTVTPTESSDADKDKVVNQRPSSQTQVA
QDSAVNLEIGKGVSLIAVPNVVTYTPEEAKKALNAANLQYEEVPQSSSDADKGKALAQDP
AAQAQVPPGTVVKVTVGTGLQVVQIPDGLVGKSLDEATQILTDAKLQVVSQTADSAQPAN
EVIAADPAAGTRVQEGTPVTLTVSNGNLMVMPNLVNSTPAEAVAALQARGWTGGADTLRQ
TTQEVTNPGLVGAIISQNPSSGSTVPKGTAVRVVVGVAPPPPPTTPTTPTPETTTPPATP
SPATPPAATPPAAATP
Download sequence
Identical sequences C8XIS6
WP_012813988.1.85990 gi|258650346|ref|YP_003199502.1| 479431.Namu_0077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]