SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258650937|ref|YP_003200093.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650937|ref|YP_003200093.1|
Domain Number 1 Region: 47-355
Classification Level Classification E-value
Superfamily Aldolase 3.66e-97
Family HMGL-like 0.000000000327
Further Details:      
 
Domain Number 2 Region: 491-587
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 1.03e-33
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.0000732
Further Details:      
 
Domain Number 3 Region: 423-473
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.00000000000000628
Family DmpG/LeuA communication domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258650937|ref|YP_003200093.1|
Sequence length 598
Comment 2-isopropylmalate synthase [Nakamurella multipartita DSM 44233]
Sequence
MGTPAPSRLRTPAGDIPAGQAAYNRQRPSAMPTGRYTPFAPIDLPDRTWPSKVITKAPQW
CAVDLRDGNQALIDPMTPARKRRMFNLLVQMGFKEIEVGFPAASQTDFDFVREIIEQDAI
PSDVRIQVLTQARPELIARTFEAVEGAPAALVHLYNSTSTLQRRVVFGLDRVGIRRIATD
GAEEVARWAEKYPDTDWRFEYSPESYTGTELEYAVEVCNAVSAIWQPTEQNPMVVNLPAT
VEMATPNVYADSIEWMHRNLERRNGIVLSLHPHNDRGTAVAAAELGYMAGADRIEGCLFG
NGERTGNVCLVTLGLNLFSQGIDPQIDFSDIDEIRRTVEYCNQLGVPERHPYGGDLVYTA
FSGSHQDAIKKGFDHLRRDAEAAGVEVDEFTWAVPYLPIDPKDVGRNYEAVIRVNSQSGK
GGVAYIMKTEHGLDLPRRLQIEFSRVVQEHTDTEGGEVDAKTMFSYFAEEYLERTSPVKL
VRTRFETPEEADHPFDKISATVVSNGEEVTASGAGNGPVAAFCQALTSIGHDVRVLDYVE
HALSAGGDARAAAYLECAIDGQVVWGVGIDSSITTASLKAVVSAVNRSAAVAARGTDL
Download sequence
Identical sequences C8X8C8
WP_015746020.1.85990 gi|258650937|ref|YP_003200093.1| 479431.Namu_0690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]