SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258650954|ref|YP_003200110.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650954|ref|YP_003200110.1|
Domain Number 1 Region: 52-276
Classification Level Classification E-value
Superfamily Lysozyme-like 2.81e-65
Family PBP transglycosylase domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 236-255,291-690
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.45e-65
Family beta-Lactamase/D-ala carboxypeptidase 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|258650954|ref|YP_003200110.1|
Domain Number - Region: 696-723
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258650954|ref|YP_003200110.1|
Sequence length 761
Comment peptidoglycan glycosyltransferase [Nakamurella multipartita DSM 44233]
Sequence
MSGLGRLILGTLLAGVLVAGLLLPYSVGMGIASNAVTDAIDGAQADPLTAEIPLRTTVTD
ATGAPIATLYNQNRVYVPLSSISDYLQVAVVSMEDRRFYQHQGVDWRGTVRAMLRNAQAD
AAAQGGSTLTQQYVKNYLYLVEAKTEAEKADAIATTPIRKLKEAKLALQVEQTLSKAEIL
ERYLNLVAFGPSQYGAEAASQWFFGTSADKLTLAQAALLAGMVNNPPKYNPLDENHVQDA
RDRRDLVLDVMVSTGRLSKATAEATKQQDLGLNPKRTRNGCIPADNSQTNGYFCQYVLDY
LSNAGFDSDTVAEAGWTIKTTMDPTVMAAAKAAATANADPSVPGVERIANTVAVVGKDEP
RKVLALAANRPYGLDPTKGETVQRLPTTFAPLGAGSTFKIFTAAAAMEMGLGTNTTIDVP
AQYESPLVPSATFKNATSYPTSMTLAQALATSPNTGFVALEDQVGLQKVAEMAVRLGLKG
YQLDAGDVDPAFASAGTDYTAQVTAQKMASFTLGVSPVSPLELANVGATLNSDGKWCPPT
PVDTITDRNGKFVTWDKTPCEQAVPAELARTLAVAMEGDFTGSGTAAASASAAGWSWTAA
GKTGTTQEYKSSAFLGFTPEMSASVIAWDSEPRPQSICKDPIRSCSTDEAMSGSGMGGGS
IPAATWMATMKPLKENQPDTFFRPASTTYIKGSASTQVPNVVGKNVDDAKTLLTAAGFTV
AVAPKQDTGASVNIVVDQNPKTTALPGGQITLGVSAGGSGG
Download sequence
Identical sequences C8X8E5
479431.Namu_0707 WP_015746037.1.85990 gi|258650954|ref|YP_003200110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]