SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258651001|ref|YP_003200157.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258651001|ref|YP_003200157.1|
Domain Number 1 Region: 232-469
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.12e-54
Family Bacterial dinuclear zinc exopeptidases 0.00000368
Further Details:      
 
Domain Number 2 Region: 134-240
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000432
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258651001|ref|YP_003200157.1|
Sequence length 512
Comment aminopeptidase S [Nakamurella multipartita DSM 44233]
Sequence
MRGARRAGVVLLSTLLLVGGLLAPPAGAAAGKETKLAEQLVKNVTVGGANRHLIALQRIA
DANGGNRAVINGTTVSDPAGYRASVDYVAGQMRSYGFKVQVKDFQYEVSDYVGQSLVVGG
GTFTVYKMNESIDTPAGGLTGPLAVVPEDGTTGCEAADFASQTYTGTIALIRRGGCTFAQ
KATNAAAAGAVAAVVSNNVPGPLTNVTITTPGPIPVGGISQADGDTLKTQGGTSATVDMR
VVPATKTAQQVIAQTRTGRTDNVVMLGAHLDSVAAGPGINDNGSGSAALLEIASKLGGSP
KTNNAVRFAWWGAEELGLLGSEAYVNGLTFSQQLDIAMYLNFDMIGSPNAGYFVYDGDDS
DQEGSGSGPYGSAQIEQTFVNFFNDRLKVQTEGTDFDGRSDYGPFIAVGIPSGGLFTGAE
QLKTADQVSLWGGTAGVAYDKCYHQACDNLGNVDRVALDRNLDAAAWATGIYGYSTEDIN
GVPPRDKRAQLRAQSQRMSLMAAPDEHAADAA
Download sequence
Identical sequences C8X9A0
479431.Namu_0754 WP_015746084.1.85990 gi|258651001|ref|YP_003200157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]