SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258651359|ref|YP_003200515.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258651359|ref|YP_003200515.1|
Domain Number 1 Region: 4-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.89e-59
Family G proteins 0.000000201
Further Details:      
 
Domain Number 2 Region: 304-396
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.32e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000926
Further Details:      
 
Domain Number 3 Region: 206-303
Classification Level Classification E-value
Superfamily Translation proteins 3.74e-30
Family Elongation factors 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258651359|ref|YP_003200515.1|
Sequence length 396
Comment translation elongation factor Tu [Nakamurella multipartita DSM 44233]
Sequence
MAKAKFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLADKYPTLNQASAFDQIDKAPEERQ
RGITINIAHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTKE
HVLLARQVGVPYILVALNKSDMVDDEEILELVELEVRELLAGQDFDEDAPVIRTSGLKAL
EGDPEWVKTVEDLMDAVDESIPEPERDTDKPFLMPIEDVFTITGRGTVVTGKVERGVINV
NATVEIVGIKPKSFQTTVTGIEMFRKLLDTAQAGDNAGLLLRGTKREDVERGQVVVKPGS
ITPHTEFEAQVYILGKDEGGRHTPFFNNYRPQFFFRTTDVTGVVNLPEGTEMVMPGDTTE
MTVQLIQPIAIEEGLRFAIREGGRTVGAGSVTKIIK
Download sequence
Identical sequences C8XCG1
gi|258651359|ref|YP_003200515.1| WP_015746440.1.85990 479431.Namu_1119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]