SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258651381|ref|YP_003200537.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258651381|ref|YP_003200537.1|
Domain Number 1 Region: 5-61
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 4.06e-16
Family Ribosomal protein L30p/L7e 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258651381|ref|YP_003200537.1|
Sequence length 67
Comment 50S ribosomal protein L30 [Nakamurella multipartita DSM 44233]
Sequence
MSDQKVKVTQVKSTIGNKRGARESVRSLGLRKIHQSVVVDDNAVNRGYINRASHLLTVEV
VQGSDAS
Download sequence
Identical sequences C8XCI3
WP_015746462.1.85990 gi|258651381|ref|YP_003200537.1| 479431.Namu_1141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]