SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258651853|ref|YP_003201009.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258651853|ref|YP_003201009.1|
Domain Number 1 Region: 4-492
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.66e-197
Family Heme-dependent catalases 0.000000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258651853|ref|YP_003201009.1|
Sequence length 508
Comment catalase [Nakamurella multipartita DSM 44233]
Sequence
MTATEPRPATTTDAGIPVASDEHSLTIGPDGPLLLQDHYLLEQMANFNRERIPERQPHAK
GGGAYGTFEVTQDVSAYTRAAVFAPGAKTDLLIRFSTVAGERGSPDTWRDPRGFSIKFYT
SEGNLDIVGNNTPVFFIRDPMKFQHFIRSQKRRSGNNLRDHDMQWDFWTLSPESAHQVTW
LMGDRGIPRTWRHMNGYSSHTYLWINAAGEKFWVKYHFKTDQGVECFTQDEADQMAAVDT
DYHQRDLWEHLEAGEFPSWTLKMQIMPFEEAKTYRFNPFDLTKVWPHSDYPLHEVGRLTL
NRNVTDYHTEIEQAAFEPNNLVAGTGLSPDKMLLARGFSYADAHRARLGVNYKQIPVNAP
KVPVHAYSKDGRMRITPVTDPVYAPNSYGGPAADPSLTDDGGRWHADGEMVRTAYTLRPE
DDDWGQAGTLVREVLDDAARGRLVDNIVGHLLNGVSEPILARAFEYWRNVDKNLGDRVEQ
GVRAKQDEKDPKAAKQGNPARESMQAKA
Download sequence
Identical sequences C8XFQ9
WP_015746924.1.85990 479431.Namu_1629 gi|258651853|ref|YP_003201009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]