SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258652105|ref|YP_003201261.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652105|ref|YP_003201261.1|
Domain Number 1 Region: 17-161
Classification Level Classification E-value
Superfamily RNase III domain-like 7.67e-43
Family RNase III catalytic domain-like 0.0000989
Further Details:      
 
Domain Number 2 Region: 118-229
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.99e-24
Family Double-stranded RNA-binding domain (dsRBD) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258652105|ref|YP_003201261.1|
Sequence length 249
Comment ribonuclease III [Nakamurella multipartita DSM 44233]
Sequence
MPSANNTPDPLAISAALGVELSPELVVLALTHRSFAYEHGGLPTNERLEFLGDSVLGVVV
TETLYRTHPELQEGRLAKLRASVVNMHALAGVGRTIGLGDQLRLGKGEELTGGRDKSSIV
ADAVEAVIGAVYLQHGLEVARAVVLRLFADLLATAPQLGAGLDWKTSLQELAAERGLGVP
EYRVSEEGPDHAKVFAARVLLSGSARGTGTGRTKKEAEQNAAAAAYTGLQDGAAGRSRPD
TPDASRSSA
Download sequence
Identical sequences C8XH66
479431.Namu_1883 gi|258652105|ref|YP_003201261.1| WP_015747173.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]