SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258652449|ref|YP_003201605.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652449|ref|YP_003201605.1|
Domain Number 1 Region: 172-218,275-410,547-660
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-67
Family Subtilases 0.0032
Further Details:      
 
Domain Number 2 Region: 463-530
Classification Level Classification E-value
Superfamily PA domain 0.0000157
Family PA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258652449|ref|YP_003201605.1|
Sequence length 1099
Comment peptidase S8/S53 subtilisin kexin sedolisin [Nakamurella multipartita DSM 44233]
Sequence
MVTASLLASALLPATAGAEPADAGNLTGTAIEVADRVSVPKAATSRLAESDPAVLAATGT
DTVPVMVKLDYDSVATYTGGVADLAPTSPAETDKSLQDNAGAVQEYEQHVAGVEDSFVAD
LAAAVPDAEVGTRLRTVYGGVSVRLPADQAKNLLDIPGVVAVQADHLNQPLTDSSPAFIG
APTIYNALGSSTTAGSGVIVGVLDSGAWPEHPSFADPGLPAPPPLANGQARVCDFGDNPL
TPANDVFVCNNKLISGQPFLQTYNANNSGEIYPDSARDSNGHGTHTASTAAGSPVADAQT
LGVSRGPIQGIAPGAHVAVYKVCGAQGCYSSDSADAVQQAINDGVDVINFSISGGTNPFT
DPVELAFLDAYGAGVFVSTSAGNDGPGAGTANHLAPWVTTVAASTQTRAFQSTLTVTGSG
AAPFVATGASITAGAGPAPVVLASSAPYGNALCSAPAPAGLFDGKIVACQRGGNARVDKG
YNVKQGGAAGMILYNPSLADVETDNHWLPTVHLADGTAFLAYLGAHPDATASFTAGVKAN
GQGDVMAAFSSRGPAGSSIKPDLTAPGVEILAGQTPTPESTTEGPPGQYFQAIAGTSMSS
PHVAGSAALLRALHPDWTPGQIKSALMTTAITKVVKEDTTTAADPFDMGAGRIDLTKAGN
PGVTFDESARGFLKAGQNPVAVADLNQPSIDVPTLPGLVTVKRTATNVTGGTIRYTTSAA
SPDGSTITVRPRSFTLRKGQSVELSVTIDATKLAPGTTAAQFGQIQLTEIGGKARDAHLP
VAFTPGSAAVTLTNTCDPSTITLRPVTASTCTVTAANTGAAPVTVDLRTSVSNRLRITGV
QGATRDSTTSVALSKVTLAGNRPGTPSIASGRSPVGYRALASLGIAPQAIGDEEMANFTV
PAFQYNGQSFTSIGVSSNGYLVVGGGTSEDQAYEPQTLPDPAKPNNVLAPFWTDLDGTGA
PGISVASLTDGKHSWVVVQWQVKVFGTANARTFQTWIGVNGTQDISFAYDPDNLPAAPGS
QALTVGAENSDGSGGGQISGLPTGDLVVTSTDPQPGGSVSYTLEVQGASTGTGTVTSTMT
SPSILGTTVKEATITVNRR
Download sequence
Identical sequences C8XJF1
479431.Namu_2239 gi|258652449|ref|YP_003201605.1| WP_015747507.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]