SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258652599|ref|YP_003201755.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652599|ref|YP_003201755.1|
Domain Number 1 Region: 2-333
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-53
Family Protein kinases, catalytic subunit 0.000000453
Further Details:      
 
Weak hits

Sequence:  gi|258652599|ref|YP_003201755.1|
Domain Number - Region: 638-699
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 433-494
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 365-426
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258652599|ref|YP_003201755.1|
Sequence length 702
Comment serine/threonine protein kinase with PASTA sensor(s) [Nakamurella multipartita DSM 44233]
Sequence
MTGRYEIGDEVGRGATSVVHRGRDLRLQRDVAIKVLRADRHQDPAFRARLRQQAAAAAVL
NHPGIVAVYDTGELPPEDEHAGDPFIVTEWVDGRTLRAELDADGPPPIDRTVALVSEVCR
ALDFSHKQGILHRAVRAENVMLARDGDRESVKVMDFGMPTTFAPAGNMPAGRRAGPAGAA
PDLPAWAAGSLAPEQVRGEPLDARTDVYGAGCLLYELLTGTVPFTGDDAVAVAVRVAGEP
VRPPGELAPSVPAELDAVVLTALAKDPLDRYQSAADLRADLARVRVGTPALAAVGAARPG
PVGSPPLLAPPTRNRRVDEGEPAPPPRSRRVAAAVGFGIVSALALAAAIWLTMSVLGTPP
PARPIAVPDLSGMPLDQARQVLADKGLTAGAVTQADSSAADVGKVVQQRPSGLTQVVGGS
PVALVVGRGVSSVALPDLAGLTPDQARSALSAVGLTYAEQQQPSADPDRGKVLAQSPAAH
LAAPPGSTVIVTVGTGLTLVTVPDGIVGVGVEEATAILTGAGLSAVGVEQDGVQPRGVVI
GTDSAPGQRVPEGSPITLNYSNNALMVMPSLVGRGRDAAAGLLQDQGWAGDASTIGTTSA
PAPSPNLIGAIVSQQPAAGSVVPKLGTPVSVGVGVKQITMPALVGRTRAEAQNLLRAAGA
TAVTVTDAGPPPRGKSGRVASQSVPAGTAITADTAVVIAIYG
Download sequence
Identical sequences C8X6B1
gi|258652599|ref|YP_003201755.1| 479431.Namu_2392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]