SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258652751|ref|YP_003201907.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652751|ref|YP_003201907.1|
Domain Number 1 Region: 22-67,112-155
Classification Level Classification E-value
Superfamily DsrEFH-like 0.00000000000000393
Family DsrH-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258652751|ref|YP_003201907.1|
Sequence length 170
Comment hypothetical protein Namu_2562 [Nakamurella multipartita DSM 44233]
Sequence
MTTTETAPAIVPQFDTENNGRKLAIICSKGTLDMAYPGLVLANAALGEGIETHLFFTFWG
FEMINKKTMNDLQFTLLGNPATHMPQGLGGLPWMTAMATSKLKKSIAEVGVPEIPEFLEQ
IVASGGHLWACRMSADMNHLTEDDLYDQVEGIISASDFIEKTEGAQLLFI
Download sequence
Identical sequences C8X7G5
gi|258652751|ref|YP_003201907.1| 479431.Namu_2562 WP_015747800.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]