SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258652759|ref|YP_003201915.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652759|ref|YP_003201915.1|
Domain Number 1 Region: 1-325
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.01e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0067
Further Details:      
 
Domain Number 2 Region: 332-453
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.95e-27
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 445-551
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.51e-25
Family Single-domain sulfurtransferase 0.047
Further Details:      
 
Domain Number 4 Region: 681-726,776-821
Classification Level Classification E-value
Superfamily DsrEFH-like 4.56e-18
Family DsrEF-like 0.015
Further Details:      
 
Domain Number 5 Region: 594-664
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000000719
Family SirA-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258652759|ref|YP_003201915.1|
Sequence length 834
Comment FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nakamurella multipartita DSM 44233]
Sequence
MKIVVVGGVAAGMSCAARARRLDESAEIVVFERANHVSFANCGLPYHIGEVIKDRSRLLL
QTPQSLHESLAIDVRIATEVLAIRPDRKSVTVRDLDSGREYEEPYEQLALCPGASPITPP
LPGVDHPDIHVLRRIGDMDVIKAAVDGRSASGRPPITHGVVIGAGYIGLEMAENLHERGV
QVVVVEMADQIMPPLDRELTTTMESYIRAHGVELRLGTQAAAFSRSPGGWLRVELTNGEF
VQTDLVLLAAGVRPSTELAVAAGIDLGPRGGIKVDAHMRTSVPGIYAAGDAIEVEHLVLP
GTWLIPLAGPANRQGRVAAENMCGRDTVFDPVQGTSIVKVFDMVAGGTGANQRQLDAAGV
PYERVQIHPSGHAGYYPGTAKMQLKVLFEPVTGKLLGAGIVGFDGVDKRLDVLATALRGG
MTVHDLEGLELAYAPPFGSAKDPINMAGFVAANLLKKDLRLWYPSEYPGATDGARIIDVR
GPQEYAIWHLPGAENVPLPTLREAQQDWDRSRPIRLYCAVGFRSYLAYRALVQRGFTDVR
TLSGGMTTFRSYHDVPSAESVDTIEPVVNYGEDRTGINAVRVTAAGPVAATGVLVDLDCT
GLACPGPIMALQARMAELAPGDEVLAHVSDPGFRLDAPAWAAKNGHSMLELVPEGPGYAA
RFRKGGIGIVPGGPAARLKDKKSFVVFSGEFDRVLASFILANAAASMGDEVSMFFTFWGL
NALRRLDPPTREKNALDRAFSAVLPSGPDSLPLSTMNMFGGGPALIKKIMKDHHVPSLPE
LIASAQQTGVRLIACTMTMDLLGIAHEDLIDGVELGGAAMFFGEANESNGAFFI
Download sequence
Identical sequences C8X7H3
479431.Namu_2572 gi|258652759|ref|YP_003201915.1| WP_015747808.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]