SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258653386|ref|YP_003202542.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258653386|ref|YP_003202542.1|
Domain Number 1 Region: 14-309
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.00000165
Further Details:      
 
Domain Number 2 Region: 658-715
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|258653386|ref|YP_003202542.1|
Domain Number - Region: 528-571
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 577-702
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.036
Family Enolpyruvate transferase, EPT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258653386|ref|YP_003202542.1|
Sequence length 718
Comment serine/threonine protein kinase with PASTA sensor(s) [Nakamurella multipartita DSM 44233]
Sequence
MDVVTGPASGTVLDGRYRLGAMIARGGMSTVYRGLDTRLDRPVAVKVMSPQYVADPTFLS
RFEREARLAASLGHPGVVAMYDQGQDGDLVFLVMELVDGGTLRDLIRERGPLPVPVVLAV
LDPLLDALAAAHAAGLVHRDVKPENVLISARGSVKIADFGLVRAVGSQTVATGDVILGTV
AYLSPEQVATGVSDARTDVYAAGIVAFEMLTGRPPFEGDNPMSVAYQHVHSDVPAPSTRV
DDVPAQLDELIVAATARNPDDRPRDASAFLAELRDVRTALHLPIVPVPIPVRPRPSPTPP
VPVPIDHPAGQTGTRMLPADAASTAYTADTAKTAEGAATTPPTRVQKRPPPVARTRTAAA
RRRRRWLIALLVVLLLGLISAAGGWWLGGRWAATPAAAGLTQSQAEAAVREAGLVPRVTT
GHSDTVPDGVVIGTDPDSGVEQLRGSEVSVLVSAGRPRVPDIKAGTDTATATAALTAADL
TVVTGTGQEFDDAVPVGAVLRTDPVGGTELSVDAPVTLILSAGPRPIVVPQVVGQSQADA
TKSLTDAGFTIGTVTKTFDARVEPGRVLRTDPTVGSTAARGSAVALTVADSITVPDVRGR
STKDAIAAMRDAGFSVTVGDPAFDAGVDAGDILRSDPGPGTRVDRTGASVFLVPSNAVTV
PDLTDQKVKDAERTLADLGLKIDVTSFFGGDNGTVWNQSPAAGGRVRPGDTVSVYVLR
Download sequence
Identical sequences C8XCV0
479431.Namu_3222 gi|258653386|ref|YP_003202542.1| WP_015748420.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]