SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654204|ref|YP_003203360.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654204|ref|YP_003203360.1|
Domain Number 1 Region: 18-286
Classification Level Classification E-value
Superfamily Aldolase 5.68e-62
Family HMGL-like 0.000000108
Further Details:      
 
Domain Number 2 Region: 301-349
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.00000000000000337
Family DmpG/LeuA communication domain-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258654204|ref|YP_003203360.1|
Sequence length 352
Comment 4-hydroxy-2-ketovalerate aldolase [Nakamurella multipartita DSM 44233]
Sequence
MTTIEQTIANSTTSDRPFVRLTDSTLRDGSHAVRHQFTTDNVTDVVTALDAAGVSVIEVT
HGDGLAGSSFNYGFGKHTDAELVAAAVRAATRAKIAVLVLPGLGTVHDLKQVHSAGAQIA
RVATHCTEADVSVEHFTAARELGMETVGFLMLSHRIGPEQLAKQARIMADAGCQCVYVVD
SAGALLPDMVRDRVQALVAELGDDAQVGFHGHQNLSLGVANSIVAYENGARQIDGTLCAL
GAGAGNSPTEILATVFDVMGVPTGVDAAKVLDAAEDIVKPMITRMPVADRASIVQGRYGV
YNSFLLHAERAADRYGVSSHEILRKVGEAGYVGGQEDMIIDVAIGLAAQRTG
Download sequence
Identical sequences C8XHR8
gi|258654204|ref|YP_003203360.1| 479431.Namu_4081 WP_015749196.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]