SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654248|ref|YP_003203404.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654248|ref|YP_003203404.1|
Domain Number 1 Region: 89-154
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 1.57e-17
Family C-terminal domain of arginine repressor 0.0011
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.79e-17
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258654248|ref|YP_003203404.1|
Sequence length 162
Comment arginine repressor ArgR [Nakamurella multipartita DSM 44233]
Sequence
MNPLATKAARHGRITDLIRDHEIRSQTELMALLSQAGLSVTQATLSRDLEELGALKLRGV
DGGPPVYRIPEDGHPRPMAGGTDRLARLLGELLLSFDGSANLAVLRTPPGAAQYLASAID
RASLADIVGTIAGDDTILVVARDGLTGAQVGRMLAGLAAGDS
Download sequence
Identical sequences C8XIF0
479431.Namu_4126 WP_015749240.1.85990 gi|258654248|ref|YP_003203404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]