SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654496|ref|YP_003203652.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654496|ref|YP_003203652.1|
Domain Number 1 Region: 41-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.72e-53
Family G proteins 0.00000059
Further Details:      
 
Domain Number 2 Region: 350-449
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.28e-21
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 251-343
Classification Level Classification E-value
Superfamily Translation proteins 4.57e-19
Family Elongation factors 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258654496|ref|YP_003203652.1|
Sequence length 476
Comment sulfate adenylyltransferase large subunit [Nakamurella multipartita DSM 44233]
Sequence
MSTVVNDSAAVTEVVGAGAAGVDTASEAHELAQELSHARGLLRFATAGSVDDGKSTLVGR
LLHDSKSVLSDQLDAVERTSQARGLETVDLSLLVDGLRAEREQGITIDVAYRYFATPTRT
FILADTPGHVQYTRNTVTGASTADLVVILTDARTGVVAQTRRHAAVAALLGVPHLLLAVN
KIDLVDYDQGVFDAIAGEFSAYAKGLGIHEITSIPISALNGDNVVTRSERIDWYDGPSVL
EHLETVDLAADTDEALRFPVQYVIRPRSDELPDYRGYAGRVGAGTVRPGDEVVVLPSGRR
STVTGIDTADGPRPSATKGDSVTLLLSDDVDLSRGDLIAGVQDAPTPVVEFTATVTQLAD
KPLKPGARTLLRYGATSTRALVTSLDHLLDIDSLTYGPAPESLALNDIAQVTIRTADAVP
VEAYRPGGAVGSLLIIDPADGTTLAAGMVGDRLAALHPETTTPAAPAAETEEDWLS
Download sequence
Identical sequences C8XKK6
WP_015749487.1.85990 479431.Namu_4376 gi|258654496|ref|YP_003203652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]