SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654726|ref|YP_003203882.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654726|ref|YP_003203882.1|
Domain Number 1 Region: 123-200
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000164
Family Multidrug-binding domain of transcription activator BmrR 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258654726|ref|YP_003203882.1|
Sequence length 210
Comment hypothetical protein Namu_4614 [Nakamurella multipartita DSM 44233]
Sequence
MCPSPMKIDFKKTLDCYQARRGQFRIVDVPDLQYLMIDGHGDPNTAPAYAGALAALYPVA
YKLKFASKRELGRDYVVPPLEALWWATDMAAFTARRDKSQWDWTVMIMAPEWITGAMVEA
ARATVAATAPPSSSLDALRLDTLHEGRCVQTLHVGPYDAEAEVLAELHHGFIPAADLRMT
GKHHEIYLSDARRVEPAKLRTILRQPVADA
Download sequence
Identical sequences C8X6Z5
gi|258654726|ref|YP_003203882.1| 479431.Namu_4614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]