SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654878|ref|YP_003204034.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654878|ref|YP_003204034.1|
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.96e-37
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258654878|ref|YP_003204034.1|
Sequence length 145
Comment phosphoenolpyruvate-dependent sugar phosphotransferase system EIIA 2 [Nakamurella multipartita DSM 44233]
Sequence
MSDILTASQIKTPGTATNKDEAIREAGQILVDSGAVGPEYIDAMFEREKSVSTYMGNFLA
IPHGTNEAKDSIKASALSVVRYENPIDWDGNEVRFAIGIAGYEGGHLEILGKVAIIFSDM
DEVDKLVAAGSSQEIFDLLNAVNED
Download sequence
Identical sequences C8X8U7
WP_015749857.1.85990 479431.Namu_4769 gi|258654878|ref|YP_003204034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]