SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258650498|ref|YP_003199654.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650498|ref|YP_003199654.1|
Domain Number 1 Region: 209-340
Classification Level Classification E-value
Superfamily CBS-domain pair 1.77e-25
Family CBS-domain pair 0.0016
Further Details:      
 
Domain Number 2 Region: 343-422
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-17
Family CorC/HlyC domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258650498|ref|YP_003199654.1|
Sequence length 425
Comment hypothetical protein Namu_0234 [Nakamurella multipartita DSM 44233]
Sequence
MGIWLNLLVVLLLLIIGGLFTATELALVSLRPGELADLRAQGPRGARVARLAGQPTRFLG
AVQIGSIVAGFFAAAYATATLAEPLGAAMGRAGLGEDGGETLAVLIVTLATTFLALIMAE
LTPRRYAMQRPQSVAALLGPILDRLATLLRPVIWLLEKCTNGLLRLLRVDPKDSRAEMSV
EEVRELVLAHEEVPDQEKQIIRQVFAAGERTIRQAMVPRAAIDFLSTAATGAQARRAAWE
HTHTRYPVLDEAGQVAGFLHVRDLFAPELDPGAPIRDLVRPISAYPPNKKLLAVLREMQT
GAENIAAVVDEYGQLKGMVTLEDVVEELVGEMYDEYDRIPTATPGDATVVDGLTGLSDFG
RRLGFELPAGRYDTVGGYLQAALDRTPRAGDAVEVAGHRLTVSSVAGWRVGQVTVEPLST
PVQPD
Download sequence
Identical sequences C8XJY2
gi|258650498|ref|YP_003199654.1| WP_012814140.1.85990 479431.Namu_0234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]