SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258654728|ref|YP_003203884.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258654728|ref|YP_003203884.1|
Domain Number 1 Region: 6-148
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000235
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258654728|ref|YP_003203884.1|
Sequence length 153
Comment transcriptional activator ligand binding domain-containing protein [Nakamurella multipartita DSM 44233]
Sequence
MTDPVTVLTVHPRSLAAVRCEVAPGEVSTAWGPAIGKVWDFIRSRPGLWTDGHNIFVYHH
PDQPGAPIVCEFGVEVTGPFPPVGDVYATATLGGEAAVAVHRGRYDRMPETYRAITEWMA
ANRRESAGHSWEIYGDPTPDPSRTETTIVHLLK
Download sequence
Identical sequences C8X6Z7
WP_015749710.1.85990 479431.Namu_4616 gi|258654728|ref|YP_003203884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]