SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254163019|ref|YP_003046127.1| from Escherichia coli B str. REL606

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254163019|ref|YP_003046127.1|
Domain Number 1 Region: 79-459
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.92e-120
Family GABA-aminotransferase-like 0.00000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254163019|ref|YP_003046127.1|
Sequence length 468
Comment putrescine--2-oxoglutarate aminotransferase [Escherichia coli B str. REL606]
Sequence
MIREPPEHILNRLPSSASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFL
EYRKSVTAGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQL
AKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKF
TFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDD
VAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENV
QPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLL
EQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQ
RVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSVEEA
Download sequence
Identical sequences A0A1R1KK98 E3PJY7
gi|387622741|ref|YP_006130369.1| gi|388479072|ref|YP_491264.1| gi|387622741|ref|YP_006130369.1| gi|471334640|ref|YP_007558117.1| 316385.ECDH10B_3248 316407.ygjG 413997.ECB_02942 gi|170082615|ref|YP_001731935.1| gi|254163019|ref|YP_003046127.1| gi|387613767|ref|YP_006116883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]