SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254163734|ref|YP_003046842.1| from Escherichia coli B str. REL606

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254163734|ref|YP_003046842.1|
Domain Number 1 Region: 10-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.9e-17
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254163734|ref|YP_003046842.1|
Sequence length 181
Comment TDP-fucosamine acetyltransferase [Escherichia coli B str. REL606]
Sequence
MQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNNASDSGAVVAQETDIPALRQLASAA
FAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDA
RIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLY
R
Download sequence
Identical sequences A0A0E0U6V3 A0A0E1ST99 A0A0F6CBA6 A7ZTZ2 C3SKL7 E3PNY0 G0F7E9 Q8XAR2
gi|251787050|ref|YP_003001354.1| gi|251787050|ref|YP_003001354.1| NP_312750.1.58667 gi|15833977|ref|NP_312750.1| gi|15804381|ref|NP_290421.1| gi|387885020|ref|YP_006315322.1| gi|157163264|ref|YP_001460582.1| gi|254163734|ref|YP_003046842.1| 155864.Z5301 316407.rffC 331111.EcE24377A_4301 331112.EcHS_A4007 386585.ECs4723 413997.ECB_03668 gi|386616601|ref|YP_006136267.1| gi|387614493|ref|YP_006117609.1| gi|471335288|ref|YP_007558765.1| gi|388479457|ref|YP_491649.1| gi|157159420|ref|YP_001465271.1| WECD_ECO57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]