SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256831508|ref|YP_003160235.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256831508|ref|YP_003160235.1|
Domain Number 1 Region: 17-236
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.58e-44
Family Phosphoglucomutase, first 3 domains 0.0021
Further Details:      
 
Domain Number 2 Region: 310-453
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.9e-30
Family Phosphoglucomutase, first 3 domains 0.0038
Further Details:      
 
Domain Number 3 Region: 440-550
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.71e-20
Family Phosphoglucomutase, C-terminal domain 0.0045
Further Details:      
 
Domain Number 4 Region: 210-320
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000282
Family Phosphoglucomutase, first 3 domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256831508|ref|YP_003160235.1|
Sequence length 551
Comment phosphoglucomutase [Jonesia denitrificans DSM 20603]
Sequence
MRATAEDLIDVDALVSAYYDQTPDPENIAERVTFGTSGHRGSSLDRAFNEAHIIATTAAI
VEYRRNQGIDGPLYIGRDTHALSLPAWQTALEVLIAADVHVMVDARDSYTPTPAVSHAIL
LHNGATTADGVRTSGPELADGIVVTPSHNPPRDGGFKYNPPHGGPADSDATTWIANRAND
ILRAGVSHIARIPLDRALNAPNLGKHDYLSAYVDDLASVLNLDAIRESGLHIGADPLGGA
AVEYWGAIGERYGLNLTVVNPQVDPRWGFMTLDWDAKIRMDCSSPYAMASLVDTMSGNAA
YDIATGNDADADRHGIVTPDAGLMNPNHYLAVAIHYLFSGARPQWGTNVAIGKTLVSSAL
IDRVAHGLQRQLLEVPVGFKWFVPGLINGTVGFGGEESAGASFLRADGTVWTTDKDGILL
ALLASEITAVTGKSPSQHHTDLTNELGSSWYARIDAPATREQKSTLAQLSPDQVTATTLA
GDPITERLTTAPGNNAAIGGLKVTTDNAWFAARPSGTEDVYKIYAESFVSADHLATVQTE
AKNVVSDALNN
Download sequence
Identical sequences C7QZ24
471856.Jden_0258 gi|256831508|ref|YP_003160235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]