SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256831859|ref|YP_003160586.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256831859|ref|YP_003160586.1|
Domain Number 1 Region: 4-181
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2e-46
Family Phosphoglucomutase, first 3 domains 0.00047
Further Details:      
 
Domain Number 2 Region: 258-365
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.42e-28
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 
Domain Number 3 Region: 157-255
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-25
Family Phosphoglucomutase, first 3 domains 0.00069
Further Details:      
 
Domain Number 4 Region: 359-446
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.02e-21
Family Phosphoglucomutase, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256831859|ref|YP_003160586.1|
Sequence length 450
Comment phosphoglucosamine mutase [Jonesia denitrificans DSM 20603]
Sequence
MARLFGTDGVRGLANRDVTAELALDLAVGAAHVLALRGEFRKPRPRAIVGRDPRASGEFL
SAAVAAGLASAGVDVVDVGVVPTPAVAFLTGRLGGDLGVMISASHNPMQDNGIKFFDRNG
YKLDDDVEDQIAALMGENWERPVGAKVGRIRYDYSAVDAYVDALVDTVTYSLEGLRVVVD
CAHGAASVVGPLALERAGAEVIVIGNEPDGENINHEYGATAPRRMAAATVGHSADVGVSF
DGDADRCIASDEEGIIVDGDKIMGMLAIGAAEAGRLKDNVLVTTVMSNLGLRLAMEERGI
STVQTSVGDRYVLEEMLRHGYTIGGEQSGHVLLTEFSTTGDGILTALHLLSRLAERRVKM
SELAGAITQLPQVMINVKDVDKAAARTHEGVLAAVAAEEAALGDTGRVLLRASGTEPLVR
VMVEAPTQELAQGCAQRLADVVREHLALSS
Download sequence
Identical sequences C7R168
WP_015770911.1.34072 WP_015770911.1.39474 471856.Jden_0619 gi|256831859|ref|YP_003160586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]