SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256831917|ref|YP_003160644.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256831917|ref|YP_003160644.1|
Domain Number 1 Region: 22-214
Classification Level Classification E-value
Superfamily Formyltransferase 6.02e-60
Family Formyltransferase 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256831917|ref|YP_003160644.1|
Sequence length 225
Comment phosphoribosylglycinamide formyltransferase [Jonesia denitrificans DSM 20603]
Sequence
MSTGETSPPLQAANVFSDERTRVVLLASGSGTNVRALLDAQRRDDFGARIVALVTDLPGT
GAERHAHNHGVPVTVVNFRDYTERVAWDRALREAVSQYNPDFVVSAGFMRILAPTFVQAF
PHRILNTHPALLPAFPGAHGVRDALAYGVKVTGCTLHVVDEGTDTGPIIAQVAVPVNSDD
TVETLHERIKVQEREMLTRWVSDIGHRGLVVTGRHAGLGANGSGV
Download sequence
Identical sequences C7R1C6
gi|256831917|ref|YP_003160644.1| 471856.Jden_0677 WP_015770969.1.34072 WP_015770969.1.39474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]