SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256832072|ref|YP_003160799.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256832072|ref|YP_003160799.1|
Domain Number 1 Region: 60-257
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-38
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 2 Region: 325-480
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.63e-26
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 
Domain Number 3 Region: 236-333
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.42e-17
Family Phosphoglucomutase, first 3 domains 0.0047
Further Details:      
 
Domain Number 4 Region: 483-584
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000000759
Family Phosphoglucomutase, C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256832072|ref|YP_003160799.1|
Sequence length 600
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Jonesia denitrificans DSM 20603]
Sequence
MAIPLTEDELLLLDEARTWIDNDPEGLTRHELQRLLDVITNPDNSSASKGRSSQALGDLK
DRFNGSLQFGTAGLRGALEAGPNRMNRSVVIKAAAGLGAYLTGQLPHATPQVVIGYDARH
YSKQFALDSAAVLTAAGCSVTILNHALPTPVLAYTMKRLGSDAGIVVTASHNPPQDNGYK
VYLGGRIVVDAGQGAQIVPPYDREIAQAIAATPPVRDIPRAESGWFTLDDNAVTSYVNAV
LTLKTPSPRDLTIVLTPLHGVGGSVVDKVLHRAGFDKLISVAEQYEPNADFPTVSFPNPE
EPGAIDLALTYAMRFQADLVIANDPDADRCAVAVKDPRTAAAHAHRVTTPQAAGWRMLHG
DEVGSLLGNVIAQRAAAEGKTAANAVLANSIVSSRLLSKIAEKHGLGYQSTLTGFKWIAR
AKDLVYGYEEALGYCVAPELVKDKDGISAALVIAQLAATLHAQGKTLIDELDDLAREHGL
YLTDQLSARFLDLSQIPATMSRLRATPPSALAGSPITQVVDLVDGYEGLPPTDGLLLLTD
DDTRVIVRPSGTEPKVKCYIEVISPVDSDADTAQLTTVRHEAREKITAVRADMTRALGLD
Download sequence
Identical sequences C7R2C5
WP_015771124.1.34072 WP_015771124.1.39474 gi|256832072|ref|YP_003160799.1| 471856.Jden_0834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]